CLDN15 Antibody - C-terminal region (ARP33635_T100)

Data Sheet
 
Product Number ARP33635_T100
Product Page www.avivasysbio.com/cldn15-antibody-c-terminal-region-arp33635-t100.html
Name CLDN15 Antibody - C-terminal region (ARP33635_T100)
Protein Size (# AA) 228 amino acids
Molecular Weight 24kDa
NCBI Gene Id 24146
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Claudin 15
Peptide Sequence Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gonzalez-Mariscal,L., et al., (2003) Prog. Biophys. Mol. Biol. 81 (1), 16072
Description of Target Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.
Protein Interactions GEM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLDN15 (ARP33635_T100) antibody
Blocking Peptide For anti-CLDN15 (ARP33635_T100) antibody is Catalog # AAP33635 (Previous Catalog # AAPP04693)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN15
Uniprot ID P56746
Protein Name Claudin-15
Protein Accession # NP_055158
Purification Protein A purified
Nucleotide Accession # NM_014343
Tested Species Reactivity Human
Gene Symbol CLDN15
Predicted Species Reactivity Human, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-CLDN15 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com