Product Number |
ARP33635_T100 |
Product Page |
www.avivasysbio.com/cldn15-antibody-c-terminal-region-arp33635-t100.html |
Name |
CLDN15 Antibody - C-terminal region (ARP33635_T100) |
Protein Size (# AA) |
228 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
24146 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Claudin 15 |
Peptide Sequence |
Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gonzalez-Mariscal,L., et al., (2003) Prog. Biophys. Mol. Biol. 81 (1), 16072 |
Description of Target |
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. |
Protein Interactions |
GEM; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLDN15 (ARP33635_T100) antibody |
Blocking Peptide |
For anti-CLDN15 (ARP33635_T100) antibody is Catalog # AAP33635 (Previous Catalog # AAPP04693) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN15 |
Uniprot ID |
P56746 |
Protein Name |
Claudin-15 |
Protein Accession # |
NP_055158 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_014343 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLDN15 |
Predicted Species Reactivity |
Human, Cow |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CLDN15 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
|
|