| Product Number |
ARP33633_P050 |
| Product Page |
www.avivasysbio.com/cldn23-antibody-c-terminal-region-arp33633-p050.html |
| Name |
CLDN23 Antibody - C-terminal region (ARP33633_P050) |
| Protein Size (# AA) |
167 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
137075 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Claudin 23 |
| Alias Symbols |
CLDNL, hCG1646163 |
| Peptide Sequence |
Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katoh,M. and Katoh,M. Int. J. Mol. Med. 11 (6), 683-689 (2003) |
| Description of Target |
CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLDN23 (ARP33633_P050) antibody |
| Blocking Peptide |
For anti-CLDN23 (ARP33633_P050) antibody is Catalog # AAP33633 (Previous Catalog # AAPP04691) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN23 |
| Uniprot ID |
Q6ZW63 |
| Protein Name |
cDNA FLJ41553 fis, clone COLON2005126 EMBL BAC85642.1 |
| Protein Accession # |
NP_919260 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_194284 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLDN23 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Pig, Yeast |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 86%; Pig: 91%; Rat: 85%; Yeast: 82% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CLDN23 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human A172 Whole Cell
 | Host: Rabbit
Target Name: CLDN23
Sample Tissue: Human A172 Whole Cell
Antibody Dilution: 1ug/ml |
| | Image 3 | Human Placenta
 | Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-CLDN23 antibody (ARP33633_P050) |
|
|
