CLDN16 Antibody - C-terminal region (ARP33632_T100)

• Product Number: ARP33632_T100
• Name: CLDN16 Antibody - C-terminal region (ARP33632_T100)
• Protein Size (# AA): 305 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 10686
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Claudin 16
• Alias Symbols: HOMG3, PCLN1
• Peptide Sequence: Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Muller,D., et al., (2003) Am. J. Hum. Genet. 73 (6), 1293-1301
• Description of Target: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.
• Protein Interactions: APP; TJP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLDN16 (ARP33632_T100) antibody is Catalog # AAP33632
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN16
• Uniprot ID: Q9Y5I7
• Protein Name: Claudin-16
• Protein Accession #: NP_006571
• Purification: Protein A purified
• Nucleotide Accession #: NM_006580
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: CLDN16
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%
• Image 1: Human Fetal Kidney
  
  WB Suggested Anti-CLDN16 Antibody
  Titration: 1.25 ug/ml
  Positive Control: Fetal kidney
• Image 2: Human Liver, 293T Cell Lysate
  
  Host: Rabbit
  Target: CLDN16
  Positive control (+): Human Liver (LI)
  Negative control (-): 293T Cell Lysate (2T)
  Antibody concentration: 1ug/ml
• Image 3: Mouse Liver
  
  Host: Rabbit
  Target Name: CLDN16
  Sample Tissue: Mouse Liver
  Antibody Dilution: 3ug/ml
• Image 4: Mouse Kidney
  
  Host: Mouse
  Target Name: CLDN16
  Sample Tissue: Mouse Kidney
  Antibody Dilution: 1ug/ml