CLDN11 Antibody - C-terminal region (ARP33628_P050)

• Product Number: ARP33628_P050
• Name: CLDN11 Antibody - C-terminal region (ARP33628_P050)
• Protein Size (# AA): 207 amino acids
• Molecular Weight: 22kDa
• NCBI Gene Id: 5010
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Claudin 11
• Alias Symbols: OSP, OTM
• Peptide Sequence: Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hosokawa,M., (2003) Glia 42 (4), 417-423
• Description of Target: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
• Protein Interactions: UBC; TSPAN3; TSPAN4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLDN11 (ARP33628_P050) antibody is Catalog # AAP33628 (Previous Catalog # AAPP04684)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN11
• Uniprot ID: O75508
• Protein Name: Claudin-11
• Protein Accession #: NP_005593
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005602
• Tested Species Reactivity: Human
• Gene Symbol: CLDN11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
• Image 1: human brain, cortex, white matter
  
  Immunohistochemistry of formalin-fixed, paraffin-embedded human brain, cortex, white matter tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 2: Human Muscle
  
  Human Muscle
• Image 3: Transfected 293T
  
  WB Suggested Anti-CLDN11 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Transfected 293T