CLDN8 Antibody - C-terminal region (ARP33621_T100)

• Product Number: ARP33621_T100
• Name: CLDN8 Antibody - C-terminal region (ARP33621_T100)
• Protein Size (# AA): 225 amino acids
• Molecular Weight: 25kDa
• NCBI Gene Id: 9073
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Claudin 8
• Alias Symbols: HEL-S-79
• Peptide Sequence: Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Clark,H.F.,et al., (2003) Genome Res.13(10),2265-2270
• Description of Target: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
• Protein Interactions: SYNE4; CCDC155; TJP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLDN8 (ARP33621_T100) antibody is Catalog # AAP33621 (Previous Catalog # AAPP04677)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN8
• Uniprot ID: P56748
• Protein Name: Claudin-8
• Protein Accession #: NP_955360
• Purification: Protein A purified
• Nucleotide Accession #: NM_199328
• Tested Species Reactivity: Human
• Gene Symbol: CLDN8
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 85%; Rat: 77%
• Image 1: Human 293T
  
  Host: Rabbit
  Target Name: CLDN8
  Sample Tissue: Human 293T
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Intestine
  
  Human Intestine
• Image 3: Human kidney
  
  Human kidney