Product Number |
ARP33615_T100 |
Product Page |
www.avivasysbio.com/cldn17-antibody-middle-region-arp33615-t100.html |
Name |
CLDN17 Antibody - middle region (ARP33615_T100) |
Protein Size (# AA) |
224 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
26285 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Claudin 17 |
Peptide Sequence |
Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Katoh,M. and Katoh,M. (2003) Int. J. Mol. Med. 11 (6), 683-689 |
Description of Target |
CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. |
Protein Interactions |
LNX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLDN17 (ARP33615_T100) antibody |
Blocking Peptide |
For anti-CLDN17 (ARP33615_T100) antibody is Catalog # AAP33615 (Previous Catalog # AAPP04671) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CLDN17 |
Uniprot ID |
P56750 |
Protein Name |
Claudin-17 |
Publications |
Anti-CK15 ARP33615_T100 has recently been referenced in the following publications: Michlig, S., Damak, S. & Le Coutre, J. Claudin-based permeability barriers in taste buds. J. Comp. Neurol. 502, 100311 (2007). 17447253 |
Protein Accession # |
NP_036263 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_012131 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLDN17 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 85% |
Image 1 | Human Lung
| Human Lung |
| Image 2 | Human Spleen
| Human Spleen |
| Image 3 | Human Jurkat
| WB Suggested Anti-CLDN17 Antibody Titration: 2.0ug/ml Positive Control: Jurkat cell lysate |
|
|