CLDN17 Antibody - middle region (ARP33615_T100)

Data Sheet
 
Product Number ARP33615_T100
Product Page www.avivasysbio.com/cldn17-antibody-middle-region-arp33615-t100.html
Name CLDN17 Antibody - middle region (ARP33615_T100)
Protein Size (# AA) 224 amino acids
Molecular Weight 25kDa
NCBI Gene Id 26285
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Claudin 17
Peptide Sequence Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Katoh,M. and Katoh,M. (2003) Int. J. Mol. Med. 11 (6), 683-689
Description of Target CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Protein Interactions LNX1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLDN17 (ARP33615_T100) antibody
Blocking Peptide For anti-CLDN17 (ARP33615_T100) antibody is Catalog # AAP33615 (Previous Catalog # AAPP04671)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CLDN17
Uniprot ID P56750
Protein Name Claudin-17
Publications

Anti-CK15 ARP33615_T100 has recently been referenced in the following publications:

Michlig, S., Damak, S. & Le Coutre, J. Claudin-based permeability barriers in taste buds. J. Comp. Neurol. 502, 1003–11 (2007). 17447253

Protein Accession # NP_036263
Purification Protein A purified
Nucleotide Accession # NM_012131
Tested Species Reactivity Human
Gene Symbol CLDN17
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 85%
Image 1
Human Lung
Human Lung
Image 2
Human Spleen
Human Spleen
Image 3
Human Jurkat
WB Suggested Anti-CLDN17 Antibody Titration: 2.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com