CLDN10 Antibody - C-terminal region (ARP33614_T100)

• Product Number: ARP33614_T100
• Name: CLDN10 Antibody - C-terminal region (ARP33614_T100)
• Protein Size (# AA): 228 amino acids
• Molecular Weight: 24kDa
• NCBI Gene Id: 9071
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Claudin 10
• Alias Symbols: OSPL, HELIX, OSP-L, CPETRL3
• Peptide Sequence: Synthetic peptide located within the following region: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gonzalez-Mariscal,L., et al., (2003) Prog. Biophys. Mol. Biol. 81 (1), 16072
• Description of Target: CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.
• Protein Interactions: VKORC1; nef;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLDN10 (ARP33614_T100) antibody is Catalog # AAP33614 (Previous Catalog # AAPP04670)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN10
• Uniprot ID: P78369
• Protein Name: Claudin-10
• Protein Accession #: NP_008915
• Purification: Protein A purified
• Nucleotide Accession #: NM_006984
• Tested Species Reactivity: Human
• Gene Symbol: CLDN10
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 87%; Rabbit: 87%; Rat: 93%
• Image 1: Human Daudi
  
  WB Suggested Anti-CLDN10 Antibody Titration: 2.5ug/ml
  Positive Control: Daudi cell lysate