CLDN18 Antibody - middle region (ARP33612_P050)

Data Sheet
 
Product Number ARP33612_P050
Product Page www.avivasysbio.com/cldn18-antibody-middle-region-arp33612-p050.html
Name CLDN18 Antibody - middle region (ARP33612_P050)
Protein Size (# AA) 261 amino acids
Molecular Weight 28kDa
NCBI Gene Id 51208
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Claudin 18
Alias Symbols SFTA5, SFTPJ
Peptide Sequence Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Karanjawala,Z.E., (2008) Am. J. Surg. Pathol. 32 (2), 188-196
Description of Target CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLDN18 (ARP33612_P050) antibody
Blocking Peptide For anti-CLDN18 (ARP33612_P050) antibody is Catalog # AAP33612 (Previous Catalog # AAPP04668)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CLDN18
Uniprot ID P56856
Protein Name Claudin-18
Protein Accession # NP_057453
Purification Affinity Purified
Nucleotide Accession # NM_016369
Tested Species Reactivity Human
Gene Symbol CLDN18
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86%
Image 1
Human Thymus
WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus
Image 2
Human Stomach Tumor, Human Liver Tumor
Host: Rabbit
Target: CLDN18
Positive control (+): Human Stomach Tumor (T-ST)
Negative control (-): Human Liver Tumor (T-LI)
Antibody concentration: 3ug/ml
Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com