Product Number |
ARP33612_P050 |
Product Page |
www.avivasysbio.com/cldn18-antibody-middle-region-arp33612-p050.html |
Name |
CLDN18 Antibody - middle region (ARP33612_P050) |
Protein Size (# AA) |
261 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
51208 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Claudin 18 |
Alias Symbols |
SFTA5, SFTPJ |
Peptide Sequence |
Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Karanjawala,Z.E., (2008) Am. J. Surg. Pathol. 32 (2), 188-196 |
Description of Target |
CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884 |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLDN18 (ARP33612_P050) antibody |
Blocking Peptide |
For anti-CLDN18 (ARP33612_P050) antibody is Catalog # AAP33612 (Previous Catalog # AAPP04668) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CLDN18 |
Uniprot ID |
P56856 |
Protein Name |
Claudin-18 |
Protein Accession # |
NP_057453 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016369 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLDN18 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86% |
Image 1 | Human Thymus
| WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Thymus |
| Image 2 | Human Stomach Tumor, Human Liver Tumor
| Host: Rabbit Target: CLDN18 Positive control (+): Human Stomach Tumor (T-ST) Negative control (-): Human Liver Tumor (T-LI) Antibody concentration: 3ug/ml |
| Image 3 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.1 ug/mL of the antibody was used in this experiment.
|
|
|