Product Number |
ARP33608_P050 |
Product Page |
www.avivasysbio.com/znf606-antibody-n-terminal-region-arp33608-p050.html |
Name |
ZNF606 Antibody - N-terminal region (ARP33608_P050) |
Protein Size (# AA) |
792 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
80095 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 606 |
Alias Symbols |
ZNF328 |
Peptide Sequence |
Synthetic peptide located within the following region: WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
ZNF606 is a new candidate transcription factor. |
Protein Interactions |
THOC7; CDK12; UBN1; THOC5; ESRRA; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF606 (ARP33608_P050) antibody |
Blocking Peptide |
For anti-ZNF606 (ARP33608_P050) antibody is Catalog # AAP33608 (Previous Catalog # AAPP04664) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF606 |
Uniprot ID |
Q8WXB4 |
Protein Name |
Zinc finger protein 606 |
Protein Accession # |
NP_079303 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025027 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF606 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 90%; Rat: 100% |
Image 1 | Human kidney
| WB Suggested Anti-ZNF606 Antibody Titration: 0.2-1 ug/ml Positive Control: Human kidney |
|
|