ZNF606 Antibody - N-terminal region (ARP33608_P050)

Data Sheet
 
Product Number ARP33608_P050
Product Page www.avivasysbio.com/znf606-antibody-n-terminal-region-arp33608-p050.html
Name ZNF606 Antibody - N-terminal region (ARP33608_P050)
Protein Size (# AA) 792 amino acids
Molecular Weight 92kDa
NCBI Gene Id 80095
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 606
Alias Symbols ZNF328
Peptide Sequence Synthetic peptide located within the following region: WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target ZNF606 is a new candidate transcription factor.
Protein Interactions THOC7; CDK12; UBN1; THOC5; ESRRA; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF606 (ARP33608_P050) antibody
Blocking Peptide For anti-ZNF606 (ARP33608_P050) antibody is Catalog # AAP33608 (Previous Catalog # AAPP04664)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF606
Uniprot ID Q8WXB4
Protein Name Zinc finger protein 606
Protein Accession # NP_079303
Purification Affinity Purified
Nucleotide Accession # NM_025027
Tested Species Reactivity Human
Gene Symbol ZNF606
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 90%; Rat: 100%
Image 1
Human kidney
WB Suggested Anti-ZNF606 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com