Product Number |
ARP33602_T100 |
Product Page |
www.avivasysbio.com/znf212-antibody-c-terminal-region-arp33602-t100.html |
Name |
ZNF212 Antibody - C-terminal region (ARP33602_T100) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
7988 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 212 |
Alias Symbols |
ZNF182, ZNFC150, C2H2-150 |
Peptide Sequence |
Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772 |
Description of Target |
ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions. |
Protein Interactions |
LOC155060; FAM90A1; SF3A3; SUV39H2; NKX2-3; ZNF408; CREB3L2; ZNF331; SAP30BP; RND1; HBP1; ZNF212; PTP4A1; ZNF3; DPF2; NFKBIA; GNL1; FHL2; DUSP6; CSK; ATF4; ATF3; PPARGC1B; ZZZ3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF212 (ARP33602_T100) antibody |
Blocking Peptide |
For anti-ZNF212 (ARP33602_T100) antibody is Catalog # AAP33602 (Previous Catalog # AAPP04658) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF212 |
Uniprot ID |
Q9UDV6 |
Protein Name |
Zinc finger protein 212 |
Protein Accession # |
NP_036388 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_012256 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF212 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 90%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 83%; Pig: 92%; Rabbit: 85%; Rat: 83% |
Image 1 | Human K562
| WB Suggested Anti-ZNF212 Antibody Titration: 1.25ug/ml Positive Control: K562 cell lysate |
|
|