ZNF212 Antibody - C-terminal region (ARP33602_T100)

Data Sheet
 
Product Number ARP33602_T100
Product Page www.avivasysbio.com/znf212-antibody-c-terminal-region-arp33602-t100.html
Name ZNF212 Antibody - C-terminal region (ARP33602_T100)
Protein Size (# AA) 495 amino acids
Molecular Weight 55kDa
NCBI Gene Id 7988
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 212
Alias Symbols ZNF182, ZNFC150, C2H2-150
Peptide Sequence Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
Description of Target ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.
Protein Interactions LOC155060; FAM90A1; SF3A3; SUV39H2; NKX2-3; ZNF408; CREB3L2; ZNF331; SAP30BP; RND1; HBP1; ZNF212; PTP4A1; ZNF3; DPF2; NFKBIA; GNL1; FHL2; DUSP6; CSK; ATF4; ATF3; PPARGC1B; ZZZ3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF212 (ARP33602_T100) antibody
Blocking Peptide For anti-ZNF212 (ARP33602_T100) antibody is Catalog # AAP33602 (Previous Catalog # AAPP04658)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF212
Uniprot ID Q9UDV6
Protein Name Zinc finger protein 212
Protein Accession # NP_036388
Purification Protein A purified
Nucleotide Accession # NM_012256
Tested Species Reactivity Human
Gene Symbol ZNF212
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 90%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 83%; Pig: 92%; Rabbit: 85%; Rat: 83%
Image 1
Human K562
WB Suggested Anti-ZNF212 Antibody Titration: 1.25ug/ml
Positive Control: K562 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com