FLJ13798 Antibody - C-terminal region (ARP33596_P050)

• Product Number: ARP33596_P050
• Name: FLJ13798 Antibody - C-terminal region (ARP33596_P050)
• Protein Size (# AA): 416 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 79831
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lysine (K)-specific demethylase 8
• Alias Symbols: JMJD5
• Peptide Sequence: Synthetic peptide located within the following region: YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
• Protein Interactions: PCYT2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KDM8 (ARP33596_P050) antibody is Catalog # AAP33596 (Previous Catalog # AAPP04652)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ13798
• Uniprot ID: Q9H8B1
• Protein Name: Lysine-specific demethylase 8
• Protein Accession #: NP_079049
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024773
• Tested Species Reactivity: Human
• Gene Symbol: KDM8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 85%
• Image 1: Human Liver
  
  WB Suggested Anti-FLJ13798 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Liver