| Product Number |
ARP33588_P050 |
| Product Page |
www.avivasysbio.com/znf668-antibody-n-terminal-region-arp33588-p050.html |
| Name |
ZNF668 Antibody - N-terminal region (ARP33588_P050) |
| Protein Size (# AA) |
619 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
79759 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 668 |
| Peptide Sequence |
Synthetic peptide located within the following region: ARSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGPADCSEEVAEVK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
ZNF668 is a new candidate transcription factor. |
| Protein Interactions |
UBC; ELAVL1; TP53; NPM1; MDM2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF668 (ARP33588_P050) antibody |
| Blocking Peptide |
For anti-ZNF668 (ARP33588_P050) antibody is Catalog # AAP33588 (Previous Catalog # AAPP04643) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF668 |
| Uniprot ID |
Q96K58 |
| Protein Name |
Zinc finger protein 668 |
| Protein Accession # |
NP_078982 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024706 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF668 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF668 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
