| Product Number |
ARP33586_T100 |
| Product Page |
www.avivasysbio.com/zinc-finger-protein-750-antibody-middle-region-arp33586-t100.html |
| Name |
ZINC FINGER PROTEIN 750 Antibody - middle region (ARP33586_T100) |
| Protein Size (# AA) |
723 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
79755 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 750 |
| Alias Symbols |
ZFP750 |
| Peptide Sequence |
Synthetic peptide located within the following region: NRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
Zinc finger protein 750 is a new candidate transcription factor |
| Protein Interactions |
CTBP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF750 (ARP33586_T100) antibody |
| Blocking Peptide |
For anti-ZNF750 (ARP33586_T100) antibody is Catalog # AAP33586 (Previous Catalog # AAPP04641) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZINC FINGER PROTEIN 750 |
| Uniprot ID |
Q32MQ0 |
| Protein Name |
Zinc finger protein 750 |
| Protein Accession # |
NP_078978 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024702 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF750 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZINC FINGER PROTEIN 750 Antibody Titration: 5ug/ml
Positive Control: HepG2 cell lysate |
|
|
