Product Number |
ARP33582_T100 |
Product Page |
www.avivasysbio.com/flj23436-antibody-n-terminal-region-arp33582-t100.html |
Name |
FLJ23436 Antibody - N-terminal region (ARP33582_T100) |
Protein Size (# AA) |
520 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
79724 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 768 |
Peptide Sequence |
Synthetic peptide located within the following region: EPESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFESQSPRYEPQSPGYE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Beausoleil,S.A., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 |
Description of Target |
FLJ23436 is a hypothetical protein |
Protein Interactions |
PASK; MDC1; BARD1; UBC; TNNT1; NDUFA12; HMP19; ZNF277; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF768 (ARP33582_T100) antibody |
Blocking Peptide |
For anti-ZNF768 (ARP33582_T100) antibody is Catalog # AAP33582 (Previous Catalog # AAPP04637) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23436 |
Uniprot ID |
Q9H5H4 |
Protein Name |
Zinc finger protein 768 |
Sample Type Confirmation |
ZNF768 is supported by BioGPS gene expression data to be expressed in Raji |
Protein Accession # |
NP_078947 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_024671 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF768 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Raji
| WB Suggested Anti-FLJ23436 Antibody Titration: 1.25ug/ml Positive Control: Raji cell lysateZNF768 is supported by BioGPS gene expression data to be expressed in Raji |
|
|