FLJ23436 Antibody - N-terminal region (ARP33582_T100)

Data Sheet
 
Product Number ARP33582_T100
Product Page www.avivasysbio.com/flj23436-antibody-n-terminal-region-arp33582-t100.html
Name FLJ23436 Antibody - N-terminal region (ARP33582_T100)
Protein Size (# AA) 520 amino acids
Molecular Weight 58kDa
NCBI Gene Id 79724
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 768
Peptide Sequence Synthetic peptide located within the following region: EPESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFESQSPRYEPQSPGYE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target FLJ23436 is a hypothetical protein
Protein Interactions PASK; MDC1; BARD1; UBC; TNNT1; NDUFA12; HMP19; ZNF277;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF768 (ARP33582_T100) antibody
Blocking Peptide For anti-ZNF768 (ARP33582_T100) antibody is Catalog # AAP33582 (Previous Catalog # AAPP04637)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23436
Uniprot ID Q9H5H4
Protein Name Zinc finger protein 768
Sample Type Confirmation

ZNF768 is supported by BioGPS gene expression data to be expressed in Raji

Protein Accession # NP_078947
Purification Protein A purified
Nucleotide Accession # NM_024671
Tested Species Reactivity Human
Gene Symbol ZNF768
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 85%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%
Image 1
Human Raji
WB Suggested Anti-FLJ23436 Antibody Titration: 1.25ug/ml
Positive Control: Raji cell lysateZNF768 is supported by BioGPS gene expression data to be expressed in Raji
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com