| Product Number |
ARP33572_T100 |
| Product Page |
www.avivasysbio.com/irx1-antibody-n-terminal-region-arp33572-t100.html |
| Name |
IRX1 Antibody - N-terminal region (ARP33572_T100) |
| Protein Size (# AA) |
480 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
79192 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Iroquois homeobox 1 |
| Alias Symbols |
IRX-5, IRXA1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ogura,K., et al., (2001) Cytogenet. Cell Genet. 92 (3-4), 320-325 |
| Description of Target |
IRX1 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos. |
| Protein Interactions |
ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IRX1 (ARP33572_T100) antibody |
| Blocking Peptide |
For anti-IRX1 (ARP33572_T100) antibody is Catalog # AAP33572 (Previous Catalog # AAPP04627) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human IRX1 |
| Uniprot ID |
P78414 |
| Protein Name |
Iroquois-class homeodomain protein IRX-1 |
| Protein Accession # |
NP_077313 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024337 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IRX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-IRX1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
