APOBEC3G Antibody - N-terminal region (ARP33540_T100)

Data Sheet
 
Product Number ARP33540_T100
Product Page www.avivasysbio.com/apobec3g-antibody-n-terminal-region-arp33540-t100.html
Name APOBEC3G Antibody - N-terminal region (ARP33540_T100)
Protein Size (# AA) 384 amino acids
Molecular Weight 46kDa
NCBI Gene Id 60489
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Alias Symbols A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1
Peptide Sequence Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rose,K.M., et al., (2004) J. Biol. Chem. 279 (40), 41744-41749
Description of Target Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Protein Interactions vpr; vif; UNG1; APP; UBC; CBFB; APOBEC3G; HSPA4; gag; PTN; PRKACA; UBA52;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APOBEC3G (ARP33540_T100) antibody
Blocking Peptide For anti-APOBEC3G (ARP33540_T100) antibody is Catalog # AAP33540
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
Uniprot ID Q9HC16
Protein Name DNA dC->dU-editing enzyme APOBEC-3G
Publications

Chen, H., Wang, L.-W., Huang, Y.-Q. & Gong, Z.-J. Interferon-alpha Induces High Expression of APOBEC3G and STAT-1 in Vitro and in Vivo. Int. J. Mol. Sci. 11, 3501-12 (2010). 20957108

Sample Type Confirmation

APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Daudi

Protein Accession # NP_068594
Purification Protein A purified
Nucleotide Accession # NM_021822
Tested Species Reactivity Human
Gene Symbol APOBEC3G
Predicted Species Reactivity Human, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 79%
Image 1
Human Daudi
WB Suggested Anti-APOBEC3G Antibody
Titration: 2.5 ug/ml
Positive Control: DaudiAPOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com