| Product Number |
ARP33527_T100 |
| Product Page |
www.avivasysbio.com/znf37a-antibody-middle-region-arp33527-t100.html |
| Name |
ZNF37A Antibody - middle region (ARP33527_T100) |
| Protein Size (# AA) |
561 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
7587 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 37A |
| Alias Symbols |
KOX21, ZNF37 |
| Peptide Sequence |
Synthetic peptide located within the following region: KPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSFSEKSTLTKHL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tunnacliffe,A., et al., (1993) Nucleic Acids Res. 21 (6), 1409-1417 |
| Description of Target |
ZNF37A is a new candidate transcription factor |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF37A (ARP33527_T100) antibody |
| Blocking Peptide |
For anti-ZNF37A (ARP33527_T100) antibody is Catalog # AAP33527 (Previous Catalog # AAPP04578) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF37A |
| Uniprot ID |
P17032 |
| Protein Name |
Zinc finger protein 37A |
| Protein Accession # |
NP_003412 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003421 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF37A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF37A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
