Product Number |
ARP33517_P050 |
Product Page |
www.avivasysbio.com/znf23-antibody-n-terminal-region-arp33517-p050.html |
Name |
ZNF23 Antibody - N-terminal region (ARP33517_P050) |
Protein Size (# AA) |
643 amino acids |
Molecular Weight |
73kDa |
NCBI Gene Id |
7571 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 23 (KOX 16) |
Alias Symbols |
KOX16, ZNF359, ZNF612, Zfp612 |
Peptide Sequence |
Synthetic peptide located within the following region: MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Zhou,L., et al., (2002) Biochem. Biophys. Res. Commun. 295 (4), 862-868 |
Description of Target |
ZNF23 (GZF1) has a BTB/POZ (broad complex, tramtrack, and bric-a-brac)/(poxvirus and zinc finger) domain and 10 tandemly repeated zinc finger motifs with strong transcriptional repressive activity. |
Protein Interactions |
KRTAP10-3; APP; ZBTB9; PCBD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF23 (ARP33517_P050) antibody |
Blocking Peptide |
For anti-ZNF23 (ARP33517_P050) antibody is Catalog # AAP33517 (Previous Catalog # AAPP04568) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF23 |
Uniprot ID |
P17027 |
Protein Name |
Zinc finger protein 23 |
Protein Accession # |
NP_666016 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_145911 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF23 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rat: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF23 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|