Product Number |
ARP33514_P050 |
Product Page |
www.avivasysbio.com/znf21-antibody-middle-region-arp33514-p050.html |
Name |
ZNF21 Antibody - middle region (ARP33514_P050) |
Protein Size (# AA) |
620 amino acids |
Molecular Weight |
72kDa |
NCBI Gene Id |
7569 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 182 |
Alias Symbols |
KOX14, ZNF21, HHZ150, Zfp182 |
Peptide Sequence |
Synthetic peptide located within the following region: RTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Knight,J.C., et al., (1994) Genomics 21 (1), 180-187 |
Description of Target |
Located on chromosome X, ZNF21 encodes a zinc finger protein 21. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF182 (ARP33514_P050) antibody |
Blocking Peptide |
For anti-ZNF182 (ARP33514_P050) antibody is Catalog # AAP33514 (Previous Catalog # AAPP04565) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF21 |
Uniprot ID |
Q96QH7 |
Protein Name |
Zinc finger protein 182 |
Protein Accession # |
NP_001007089 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001007088 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF182 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF21 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
| Image 2 | Human Pancreas
| Human Pancreas |
|
|