ZNF21 Antibody - middle region (ARP33514_P050)

Data Sheet
 
Product Number ARP33514_P050
Product Page www.avivasysbio.com/znf21-antibody-middle-region-arp33514-p050.html
Name ZNF21 Antibody - middle region (ARP33514_P050)
Protein Size (# AA) 620 amino acids
Molecular Weight 72kDa
NCBI Gene Id 7569
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 182
Alias Symbols KOX14, ZNF21, HHZ150, Zfp182
Peptide Sequence Synthetic peptide located within the following region: RTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Knight,J.C., et al., (1994) Genomics 21 (1), 180-187
Description of Target Located on chromosome X, ZNF21 encodes a zinc finger protein 21.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF182 (ARP33514_P050) antibody
Blocking Peptide For anti-ZNF182 (ARP33514_P050) antibody is Catalog # AAP33514 (Previous Catalog # AAPP04565)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF21
Uniprot ID Q96QH7
Protein Name Zinc finger protein 182
Protein Accession # NP_001007089
Purification Affinity Purified
Nucleotide Accession # NM_001007088
Tested Species Reactivity Human
Gene Symbol ZNF182
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF21 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Pancreas
Human Pancreas
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com