| Product Number |
ARP33513_T100 |
| Product Page |
www.avivasysbio.com/znf18-antibody-n-terminal-region-arp33513-t100.html |
| Name |
ZNF18 Antibody - N-terminal region (ARP33513_T100) |
| Protein Size (# AA) |
549 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
7566 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 18 |
| Alias Symbols |
HDSG1, KOX11, ZNF535, Zfp535, ZKSCAN6, ZSCAN38 |
| Peptide Sequence |
Synthetic peptide located within the following region: DLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fohn,L.E., et al., (2005) Int. J. Mol. Med. 15 (3), 545-548 |
| Description of Target |
ZNF18 is a candidate transcription factor |
| Protein Interactions |
TTC32; CCNC; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF18 (ARP33513_T100) antibody |
| Blocking Peptide |
For anti-ZNF18 (ARP33513_T100) antibody is Catalog # AAP33513 (Previous Catalog # AAPP04564) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF18 |
| Uniprot ID |
P17022 |
| Protein Name |
Zinc finger protein 18 |
| Protein Accession # |
NP_653281 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_144680 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF18 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 83%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF18 Antibody Titration: 5ug/ml
Positive Control: HepG2 cell lysate |
|
|
