ZNF7 Antibody - N-terminal region (ARP33509_T100)

• Product Number: ARP33509_T100
• Name: ZNF7 Antibody - N-terminal region (ARP33509_T100)
• Protein Size (# AA): 686 amino acids
• Molecular Weight: 78kDa
• NCBI Gene Id: 7553
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 7
• Alias Symbols: KOX4, zf30, HF.16
• Peptide Sequence: Synthetic peptide located within the following region: EPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Petroni,D., et al., (1998) DNA Seq. 9 (3), 163-169
• Description of Target: ZNF7 is a candidate transcription factor
• Protein Interactions: UBC; RPL7; TADA3; MAPK3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF7 (ARP33509_T100) antibody is Catalog # AAP33509 (Previous Catalog # AAPP04560)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF7
• Uniprot ID: Q8N8Y4
• Protein Name: Zinc finger protein 7 Ensembl ENSP00000435252
• Sample Type Confirmation:

  ZNF7 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_003407
• Purification: Protein A purified
• Nucleotide Accession #: NM_003416
• Tested Species Reactivity: Human
• Gene Symbol: ZNF7
• Predicted Species Reactivity: Human, Mouse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 79%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF7 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysateZNF7 is supported by BioGPS gene expression data to be expressed in Jurkat