| Product Number |
ARP33495_P050 |
| Product Page |
www.avivasysbio.com/zfp37-antibody-middle-region-arp33495-p050.html |
| Name |
ZFP37 Antibody - middle region (ARP33495_P050) |
| Protein Size (# AA) |
630 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
7539 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 37 homolog (mouse) |
| Alias Symbols |
ZNF906, zfp-37 |
| Peptide Sequence |
Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dreyer,S.D., (1998) Mamm. Genome 9 (6), 458-462 |
| Description of Target |
ZFP37 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZFP37 may be involved in transcriptional regulation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZFP37 (ARP33495_P050) antibody |
| Blocking Peptide |
For anti-ZFP37 (ARP33495_P050) antibody is Catalog # AAP33495 (Previous Catalog # AAPP04545) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZFP37 |
| Uniprot ID |
Q5T7Q4 |
| Protein Name |
Zinc finger protein 37 homolog |
| Sample Type Confirmation |
ZFP37 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_003399 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003408 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZFP37 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79% |
| Image 1 | Human 721_B
 | WB Suggested Anti-ZFP37 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateZFP37 is supported by BioGPS gene expression data to be expressed in 721_B |
|
|
