WNT8B Antibody - middle region (ARP33491_T100)

Data Sheet
 
Product Number ARP33491_T100
Product Page www.avivasysbio.com/wnt8b-antibody-middle-region-arp33491-t100.html
Name WNT8B Antibody - middle region (ARP33491_T100)
Protein Size (# AA) 351 amino acids
Molecular Weight 39kDa
Conjugation Unconjugated
NCBI Gene Id 7479
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Wingless-type MMTV integration site family, member 8B
Peptide Sequence Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Saitoh,T., et al., (2002) Int. J. Oncol. 20 (5), 999-1003
Description of Target The WNT family consists of sereval secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8B is a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WNT8B (ARP33491_T100) antibody
Blocking Peptide For anti-WNT8B (ARP33491_T100) antibody is Catalog # AAP33491 (Previous Catalog # AAPP04541)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WNT8B
Uniprot ID Q93098
Protein Name Protein Wnt-8b
Protein Accession # NP_003384
Purification Protein A purified
Nucleotide Accession # NM_003393
Tested Species Reactivity Human
Gene Symbol WNT8B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human Brain
WB Suggested Anti-WNT8B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com