Product Number |
ARP33491_T100 |
Product Page |
www.avivasysbio.com/wnt8b-antibody-middle-region-arp33491-t100.html |
Name |
WNT8B Antibody - middle region (ARP33491_T100) |
Protein Size (# AA) |
351 amino acids |
Molecular Weight |
39kDa |
Conjugation |
Unconjugated |
NCBI Gene Id |
7479 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Wingless-type MMTV integration site family, member 8B |
Peptide Sequence |
Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Saitoh,T., et al., (2002) Int. J. Oncol. 20 (5), 999-1003 |
Description of Target |
The WNT family consists of sereval secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8B is a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-WNT8B (ARP33491_T100) antibody |
Blocking Peptide |
For anti-WNT8B (ARP33491_T100) antibody is Catalog # AAP33491 (Previous Catalog # AAPP04541) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WNT8B |
Uniprot ID |
Q93098 |
Protein Name |
Protein Wnt-8b |
Protein Accession # |
NP_003384 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003393 |
Tested Species Reactivity |
Human |
Gene Symbol |
WNT8B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human Brain
| WB Suggested Anti-WNT8B Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Human brain |
|
|