| Product Number |
ARP33438_T100 |
| Product Page |
www.avivasysbio.com/tfdp2-antibody-n-terminal-region-arp33438-t100.html |
| Name |
TFDP2 Antibody - N-terminal region (ARP33438_T100) |
| Protein Size (# AA) |
386 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
7029 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transcription factor Dp-2 (E2F dimerization partner 2) |
| Alias Symbols |
DP2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Korz,C., et al., (2002) Blood 99 (12), 4554-4561 |
| Description of Target |
The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation. |
| Protein Interactions |
E2F6; UBC; E2F1; LIN9; LIN54; LIN37; RBL2; YWHAE; E2F4; E2F3; E2F2; RBL1; RB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFDP2 (ARP33438_T100) antibody |
| Blocking Peptide |
For anti-TFDP2 (ARP33438_T100) antibody is Catalog # AAP33438 (Previous Catalog # AAPP04484) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP2 |
| Uniprot ID |
Q14188-4 |
| Protein Name |
Transcription factor Dp-2 |
| Sample Type Confirmation |
TFDP2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_006277 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006286 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFDP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TFDP2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateTFDP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
| Image 2 | Human kidney
 | Human kidney |
|
