TBX6 antibody - N-terminal region (ARP33405_T100)
Data Sheet
Product Number ARP33405_T100
Product Page www.avivasysbio.com/tbx6-antibody-n-terminal-region-arp33405-t100.html
Product Name TBX6 antibody - N-terminal region (ARP33405_T100)
Size 100 ul
Gene Symbol TBX6
Protein Size (# AA) 436 amino acids
Molecular Weight 47kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6911
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name T-box 6
Description This is a rabbit polyclonal antibody against TBX6. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM
Target Reference Papapetrou,C., et al., (1999) Genomics 55 (2), 238-241
Description of Target The TBX6 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX6 is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures.
Protein Interactions HSFY1; C1orf94; RBPMS; TOX4; PSMA3; MEOX2; PRMT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TBX6 (ARP33405_T100) antibody is Catalog # AAP33405
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBX6
Complete computational species homology data Anti-TBX6 (ARP33405_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TBX6.
Swissprot Id O95947
Protein Name T-box transcription factor TBX6
Protein Accession # NP_004599
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TBX6.
Nucleotide Accession # NM_004608
Replacement Item This antibody may replace item sc-134063 from Santa Cruz Biotechnology.
Conjugation Options

ARP33405_T100-FITC Conjugated

ARP33405_T100-HRP Conjugated

ARP33405_T100-Biotin Conjugated

CB Replacement sc-134063; sc-17888; sc-517027
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-TBX6 Antibody
Titration: 5 ug/ml
Positive Control: Placenta

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com