TBX6 Antibody - N-terminal region (ARP33405_P050)

Data Sheet
 
Product Number ARP33405_P050
Product Page www.avivasysbio.com/tbx6-antibody-n-terminal-region-arp33405-p050.html
Name TBX6 Antibody - N-terminal region (ARP33405_P050)
Protein Size (# AA) 436 amino acids
Molecular Weight 47kDa
NCBI Gene Id 6911
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box 6
Alias Symbols SCDO5
Peptide Sequence Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Papapetrou,C., et al., (1999) Genomics 55 (2), 238-241
Description of Target The TBX6 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX6 is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures.
Protein Interactions HSFY1; C1orf94; RBPMS; TOX4; PSMA3; MEOX2; PRMT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBX6 (ARP33405_P050) antibody
Blocking Peptide For anti-TBX6 (ARP33405_P050) antibody is Catalog # AAP33405 (Previous Catalog # AAPP04451)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBX6
Uniprot ID O95947
Protein Name T-box transcription factor TBX6
Publications

Chen, Y.-L. et al. Smad6 inhibits the transcriptional activity of Tbx6 by mediating its degradation. J. Biol. Chem. 284, 23481-90 (2009). 19561075

Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). 18772864

Protein Accession # NP_004599
Purification Affinity Purified
Nucleotide Accession # NM_004608
Tested Species Reactivity Human
Gene Symbol TBX6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human Muscle
Human Muscle
Image 2
Human Placenta
WB Suggested Anti-TBX6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com