Product Number |
ARP33405_P050 |
Product Page |
www.avivasysbio.com/tbx6-antibody-n-terminal-region-arp33405-p050.html |
Name |
TBX6 Antibody - N-terminal region (ARP33405_P050) |
Protein Size (# AA) |
436 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
6911 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box 6 |
Alias Symbols |
SCDO5 |
Peptide Sequence |
Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Papapetrou,C., et al., (1999) Genomics 55 (2), 238-241 |
Description of Target |
The TBX6 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX6 is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures. |
Protein Interactions |
HSFY1; C1orf94; RBPMS; TOX4; PSMA3; MEOX2; PRMT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX6 (ARP33405_P050) antibody |
Blocking Peptide |
For anti-TBX6 (ARP33405_P050) antibody is Catalog # AAP33405 (Previous Catalog # AAPP04451) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX6 |
Uniprot ID |
O95947 |
Protein Name |
T-box transcription factor TBX6 |
Publications |
Chen, Y.-L. et al. Smad6 inhibits the transcriptional activity of Tbx6 by mediating its degradation. J. Biol. Chem. 284, 23481-90 (2009). 19561075
Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). 18772864 |
Protein Accession # |
NP_004599 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004608 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
Image 1 | Human Muscle
| Human Muscle |
|
Image 2 | Human Placenta
| WB Suggested Anti-TBX6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Placenta |
|