| Product Number |
ARP33403_T100 |
| Product Page |
www.avivasysbio.com/tbx5-antibody-n-terminal-region-arp33403-t100.html |
| Name |
TBX5 Antibody - N-terminal region (ARP33403_T100) |
| Protein Size (# AA) |
468 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
6910 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
T-box 5 |
| Alias Symbols |
HOS |
| Peptide Sequence |
Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Riazi,A.M., et al., (2005) J. Biol. Chem. 280 (11), 10716-10720 |
| Description of Target |
TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. |
| Protein Interactions |
KDM6A; SMARCA4; KAT5; GATA4; NKX2-5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TBX5 (ARP33403_T100) antibody |
| Blocking Peptide |
For anti-TBX5 (ARP33403_T100) antibody is Catalog # AAP33403 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5 |
| Uniprot ID |
Q99593 |
| Protein Name |
T-box transcription factor TBX5 |
| Protein Accession # |
NP_542448 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_080717 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TBX5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TBX5 Antibody
Titration: 5 ug/ml
Positive Control: HepG2 Whole Cell |
|
|
