Product Number |
ARP33403_P050 |
Product Page |
www.avivasysbio.com/tbx5-antibody-n-terminal-region-arp33403-p050.html |
Name |
TBX5 Antibody - N-terminal region (ARP33403_P050) |
Protein Size (# AA) |
518 amino acids |
Molecular Weight |
58 kDa |
NCBI Gene Id |
6910 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box 5 |
Description |
|
Alias Symbols |
HOS |
Peptide Sequence |
Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Zaragoza,M.V., et al., (2004) Gene 330, 38978 |
Description of Target |
TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX5 is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in TBX5 have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for TBX5. |
Protein Interactions |
KDM6A; SMARCA4; KAT5; GATA4; NKX2-5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-TBX5 (ARP33403_P050) antibody |
Blocking Peptide |
For anti-TBX5 (ARP33403_P050) antibody is Catalog # AAP33403 (Previous Catalog # AAPP04449) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5 |
Uniprot ID |
Q99593 |
Protein Name |
T-box transcription factor TBX5 |
Publications |
Baban, A. et al. Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: functional characterization of a de novo TBX5 mutation. Am. J. Med. Genet. A 164A, 1419-24 (2014). 24664498
Lu, J. et al. Induction of apoptosis and inhibition of cell growth by tbx5 knockdown contribute to dysmorphogenesis in Zebrafish embryos. J. Biomed. Sci. 18, 73 (2011). 21982178
The Cardiac TBX5 Interactome Reveals a Chromatin Remodeling Network Essential for Cardiac Septation. Dev Cell. 36, 262-75 (2016). 26859351
Zhang, Y., Huang, L., Zuo, Z., Chen, Y. & Wang, C. Phenanthrene exposure causes cardiac arrhythmia in embryonic zebrafish via perturbing calcium handling. Aquat. Toxicol. 142-143, 26-32 (2013). 23948075 |
Protein Accession # |
NP_000183 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000192 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Image 1 | Human Brain, cortex
| Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0ug/ml using anti-TBX5 antibody (ARP33403_P050) |
|
Image 2 | Human A549 Whole Cell
| Host: Rabbit Target Name: TBX5 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 3ug/ml |
|
Image 3 | Human HT1080 Whole Cell
| Host: Rabbit Target Name: TBX5 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 3ug/ml |
|
Image 4 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: TBX5 Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 2ug/ml |
|