TBX5 Antibody - N-terminal region (ARP33403_P050)

Data Sheet
 
Product Number ARP33403_P050
Product Page www.avivasysbio.com/tbx5-antibody-n-terminal-region-arp33403-p050.html
Name TBX5 Antibody - N-terminal region (ARP33403_P050)
Protein Size (# AA) 518 amino acids
Molecular Weight 58 kDa
NCBI Gene Id 6910
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box 5
Description
Alias Symbols HOS
Peptide Sequence Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zaragoza,M.V., et al., (2004) Gene 330, 38978
Description of Target TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX5 is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in TBX5 have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for TBX5.
Protein Interactions KDM6A; SMARCA4; KAT5; GATA4; NKX2-5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-TBX5 (ARP33403_P050) antibody
Blocking Peptide For anti-TBX5 (ARP33403_P050) antibody is Catalog # AAP33403 (Previous Catalog # AAPP04449)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5
Uniprot ID Q99593
Protein Name T-box transcription factor TBX5
Publications

Baban, A. et al. Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: functional characterization of a de novo TBX5 mutation. Am. J. Med. Genet. A 164A, 1419-24 (2014). 24664498

Lu, J. et al. Induction of apoptosis and inhibition of cell growth by tbx5 knockdown contribute to dysmorphogenesis in Zebrafish embryos. J. Biomed. Sci. 18, 73 (2011). 21982178

The Cardiac TBX5 Interactome Reveals a Chromatin Remodeling Network Essential for Cardiac Septation. Dev Cell. 36, 262-75 (2016). 26859351

Zhang, Y., Huang, L., Zuo, Z., Chen, Y. & Wang, C. Phenanthrene exposure causes cardiac arrhythmia in embryonic zebrafish via perturbing calcium handling. Aquat. Toxicol. 142-143, 26-32 (2013). 23948075

Protein Accession # NP_000183
Purification Affinity Purified
Nucleotide Accession # NM_000192
Tested Species Reactivity Human
Gene Symbol TBX5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human Brain, cortex
Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0ug/ml using anti-TBX5 antibody (ARP33403_P050)
Image 2
Human A549 Whole Cell
Host: Rabbit
Target Name: TBX5
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 3ug/ml
Image 3
Human HT1080 Whole Cell
Host: Rabbit
Target Name: TBX5
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 3ug/ml
Image 4
Human 786-0 Whole Cell
Host: Rabbit
Target Name: TBX5
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 2ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com