| Product Number |
ARP33402_P050 |
| Product Page |
www.avivasysbio.com/tbx5-antibody-middle-region-arp33402-p050.html |
| Name |
TBX5 Antibody - middle region (ARP33402_P050) |
| Protein Size (# AA) |
349 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
6910 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T-box 5 |
| Alias Symbols |
HOS |
| Peptide Sequence |
Synthetic peptide located within the following region: RMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zaragoza,M.V., et al., () Gene 330, 38613 2004 |
| Description of Target |
TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. |
| Protein Interactions |
KDM6A; SMARCA4; KAT5; GATA4; NKX2-5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TBX5 (ARP33402_P050) antibody |
| Additional Information |
IHC Information: Jurkat Cell Lysate |
| Blocking Peptide |
For anti-TBX5 (ARP33402_P050) antibody is Catalog # AAP33402 (Previous Catalog # AAPP04448) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TBX5 |
| Uniprot ID |
Q99593-2 |
| Protein Name |
T-box transcription factor TBX5 |
| Protein Accession # |
NP_542449 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080718 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TBX5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human muscle
 | Rabbit Anti-TBX5 Antibody
Catalog Number: ARP33402
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-TBX5 Antibody Titration: 0.5ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 3 | Mouse Pancreas
 | Host: Mouse
Target Name: TBX5
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml |
|
