STAT4 Antibody - N-terminal region (ARP33376_T100)

• Product Number: ARP33376_T100
• Name: STAT4 Antibody - N-terminal region (ARP33376_T100)
• Protein Size (# AA): 748 amino acids
• Molecular Weight: 86 kDa
• NCBI Gene Id: 6775
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Signal transducer and activator of transcription 4
• Alias Symbols: SLEB11
• Peptide Sequence: Synthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Torpey,N., et al., (2004) J. Biol. Chem. 279 (25), 26789-26796
• Description of Target: STAT4 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells.
• Protein Interactions: UBC; ADRB2; TRIM28; FHL1; ZNF467; PIAS2; NMI; IL12RB2; IL12RB1; MAP2K6; STAT4; MAPK14; CREBBP; JUN; STAT3; IFNGR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-STAT4 (ARP33376_T100) antibody is Catalog # AAP33376 (Previous Catalog # AAPP04422)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
• Uniprot ID: Q14765
• Protein Name: Signal transducer and activator of transcription 4
• Sample Type Confirmation:

  STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_003142
• Purification: Protein A purified
• Nucleotide Accession #: NM_003151
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: STAT4
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: Mouse Spleen
  
  Host: Rabbit
  Target Name: STAT4
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 3: Mouse Spleen
  
  Host: Mouse
  Target Name: STAT4
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 4: Human Heart
  
  Rabbit Anti-STAT4 antibody
  Catalog Number: ARP33376
  Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X