PKNOX2 Antibody - N-terminal region (ARP33366_T100)

• Product Number: ARP33366_T100
• Name: PKNOX2 Antibody - N-terminal region (ARP33366_T100)
• Protein Size (# AA): 306 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 63876
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: PBX/knotted 1 homeobox 2
• Alias Symbols: PREP2
• Peptide Sequence: Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fognani,C., et al., (2002) Nucleic Acids Res. 30 (9), 2043-2051
• Description of Target: PKNOX2 is a TALE homeodomain protein that shows distinct homology with PKNOX1. It may interact with PBX proteins and play a tissue-specific regulation of transcription.
• Protein Interactions: HOXB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PKNOX2 (ARP33366_T100) antibody is Catalog # AAP33366 (Previous Catalog # AAPP04412)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PKNOX2
• Uniprot ID: Q9H921
• Protein Name: cDNA FLJ13074 fis, clone NT2RP3001855, moderately similar to HOMEOBOX PROTEIN PKNOX1 EMBL BAB14422.1
• Protein Accession #: NP_071345
• Purification: Protein A purified
• Nucleotide Accession #: NM_022062
• Tested Species Reactivity: Human
• Gene Symbol: PKNOX2
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PKNOX2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate