SSTR4 Antibody - middle region (ARP33359_P050)

• Product Number: ARP33359_P050
• Name: SSTR4 Antibody - middle region (ARP33359_P050)
• Protein Size (# AA): 388 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 6754
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Somatostatin receptor 4
• Alias Symbols: SS4R, SS4-R, SS-4-R
• Peptide Sequence: Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pasquali,D., et al., (2002) J. Clin. Endocrinol. Metab. 87 (11), 5125-5129
• Description of Target: Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung.
• Protein Interactions: SST; CORT;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SSTR4 (ARP33359_P050) antibody is Catalog # AAP33359 (Previous Catalog # AAPP04405)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSTR4
• Uniprot ID: P31391
• Protein Name: Somatostatin receptor type 4
• Protein Accession #: NP_001043
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001052
• Tested Species Reactivity: Human
• Gene Symbol: SSTR4
• Predicted Species Reactivity: Mouse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Mouse: 85%; Rabbit: 78%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SSTR4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate