Foxl2 Antibody - middle region (ARP33358_P050)

Data Sheet
 
Product Number ARP33358_P050
Product Page www.avivasysbio.com/foxl2-antibody-middle-region-arp33358-p050.html
Name Foxl2 Antibody - middle region (ARP33358_P050)
Protein Size (# AA) 374 amino acids
Molecular Weight 39kDa
NCBI Gene Id 367152
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box L2
Alias Symbols Foxl2
Peptide Sequence Synthetic peptide located within the following region: AHFQPGKGLFGSGGGAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Foxl2 (ARP33358_P050) antibody
Blocking Peptide For anti-Foxl2 (ARP33358_P050) antibody is Catalog # AAP33358 (Previous Catalog # AAPP04404)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID D4A0S1
Protein Name Protein Foxl2 Ensembl ENSRNOP00000023091
Protein Accession # XP_001070279
Purification Affinity Purified
Nucleotide Accession # XM_001070279
Tested Species Reactivity Rat
Gene Symbol Foxl2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Rat Brain
WB Suggested Anti-Foxl2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Rat Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com