FOXL2 Antibody - N-terminal region (ARP33357_T100)

• Product Number: ARP33357_T100
• Name: FOXL2 Antibody - N-terminal region (ARP33357_T100)
• Protein Size (# AA): 376 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 668
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box L2
• Alias Symbols: BPES, PFRK, POF3, BPES1, PINTO
• Peptide Sequence: Synthetic peptide located within the following region: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tang,S., et al., (2006) Mutagenesis 21 (1), 35-39
• Description of Target: FOXL2 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
• Protein Interactions: LATS1; SUMO1; UBE2I; ELAVL1; SMAD3; PAK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXL2 (ARP33357_T100) antibody is Catalog # AAP33357 (Previous Catalog # AAPP04403)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXL2
• Uniprot ID: P58012
• Protein Name: Forkhead box protein L2
• Protein Accession #: NP_075555
• Purification: Protein A purified
• Nucleotide Accession #: NM_023067
• Tested Species Reactivity: Human
• Gene Symbol: FOXL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 84%; Dog: 100%; Goat: 92%; Human: 100%; Mouse: 84%; Pig: 100%; Rabbit: 92%; Rat: 84%
• Image 1: Human Jurkat
  
  WB Suggested Anti-FOXL2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate