FLJ11730 Antibody - N-terminal region (ARP33354_P050)

Data Sheet
 
Product Number ARP33354_P050
Product Page www.avivasysbio.com/flj11730-antibody-n-terminal-region-arp33354-p050.html
Name FLJ11730 Antibody - N-terminal region (ARP33354_P050)
Protein Size (# AA) 201 amino acids
Molecular Weight 23kDa
NCBI Gene Id 64769
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MYST/Esa1-associated factor 6
Alias Symbols EAF6, CENP-28, C1orf149, NY-SAR-91
Peptide Sequence Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,S.Y., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656
Description of Target The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them.
Protein Interactions PLEKHF2; TRIM54; LDOC1; UBC; FXR2; H2AFZ; ELAVL1; SUMO2; JADE1; KAT5; tat; MRGBP; ING5; KAT6A; BRPF1; CCDC85B; L3MBTL2; ING3; ING4; KAT7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MEAF6 (ARP33354_P050) antibody
Blocking Peptide For anti-MEAF6 (ARP33354_P050) antibody is Catalog # AAP33354 (Previous Catalog # AAPP04396)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ11730
Uniprot ID Q86WE3
Protein Name Chromatin modification-related protein MEAF6
Sample Type Confirmation

MEAF6 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_073593
Purification Affinity Purified
Nucleotide Accession # NM_022756
Tested Species Reactivity Human
Gene Symbol MEAF6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-FLJ11730 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateMEAF6 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com