Product Number |
ARP33330_T100 |
Product Page |
www.avivasysbio.com/sox12-antibody-c-terminal-region-arp33330-t100.html |
Name |
SOX12 Antibody - C-terminal region (ARP33330_T100) |
Protein Size (# AA) |
315 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
6666 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
SRY (sex determining region Y)-box 12 |
Alias Symbols |
SOX22 |
Peptide Sequence |
Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kato,N., et al., (2001) Mol. Endocrinol. 15 (3), 353-362 |
Description of Target |
Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. |
Protein Interactions |
SRM; POLD2; SMAD4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SOX12 (ARP33330_T100) antibody |
Blocking Peptide |
For anti-SOX12 (ARP33330_T100) antibody is Catalog # AAP33330 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX12 |
Uniprot ID |
O15370 |
Protein Name |
Transcription factor SOX-12 |
Protein Accession # |
NP_008874 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006943 |
Tested Species Reactivity |
Human |
Gene Symbol |
SOX12 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-SOX12 Antibody Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell |
|
|