SOX12 Antibody - C-terminal region (ARP33330_P050)

Data Sheet
 
Product Number ARP33330_P050
Product Page www.avivasysbio.com/sox12-antibody-c-terminal-region-arp33330-p050.html
Name SOX12 Antibody - C-terminal region (ARP33330_P050)
Protein Size (# AA) 315 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6666
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SRY (sex determining region Y)-box 12
Alias Symbols SOX22
Peptide Sequence Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Weiss,M.A. et al., (2001) Mol. Endocrinol. 15 (3), 353-362
Description of Target Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The SOX12 gene encodes a protein that was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.
Protein Interactions SRM; POLD2; SMAD4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX12 (ARP33330_P050) antibody
Blocking Peptide For anti-SOX12 (ARP33330_P050) antibody is Catalog # AAP33330 (Previous Catalog # AAPP04372)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SOX12
Uniprot ID O15370
Protein Name Transcription factor SOX-12
Protein Accession # NP_008874
Purification Affinity Purified
Nucleotide Accession # NM_006943
Tested Species Reactivity Human
Gene Symbol SOX12
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%
Image 1
Human Jurkat
WB Suggested Anti-SOX12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com