| Product Number |
ARP33327_P050 |
| Product Page |
www.avivasysbio.com/sox11-antibody-n-terminal-region-arp33327-p050.html |
| Name |
SOX11 Antibody - N-terminal region (ARP33327_P050) |
| Protein Size (# AA) |
441 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
6664 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 11 |
| Alias Symbols |
CSS9, MRD27 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wiebe,M.S., et al., (2003) J. Biol. Chem. 278 (20), 17901-17911 |
| Description of Target |
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. |
| Protein Interactions |
POU3F3; POU3F2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX11 (ARP33327_P050) antibody |
| Blocking Peptide |
For anti-SOX11 (ARP33327_P050) antibody is Catalog # AAP33327 (Previous Catalog # AAPP04369) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX11 |
| Uniprot ID |
P35716 |
| Protein Name |
Transcription factor SOX-11 |
| Publications |
Li, Y. et al. Sox11 modulates neocortical development by regulating the proliferation and neuronal differentiation of cortical intermediate precursors. Acta Biochim. Biophys. Sin. (Shanghai). 44, 660-8 (2012). 22687574 |
| Protein Accession # |
NP_003099 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003108 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SOX11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: SOX11
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml |
|
