ZNF447 Antibody - N-terminal region (ARP33305_T100)

• Product Number: ARP33305_T100
• Name: ZNF447 Antibody - N-terminal region (ARP33305_T100)
• Protein Size (# AA): 510 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 65982
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger and SCAN domain containing 18
• Alias Symbols: ZNF447
• Peptide Sequence: Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Protein Interactions: SAFB2; LIG4; UBA52; APP; UBC; HOXD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZSCAN18 (ARP33305_T100) antibody is Catalog # AAP33305 (Previous Catalog # AAPP04347)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF447
• Uniprot ID: Q8TBC5
• Protein Name: Zinc finger and SCAN domain-containing protein 18
• Protein Accession #: NP_076415
• Purification: Protein A purified
• Nucleotide Accession #: NM_023926
• Tested Species Reactivity: Human
• Gene Symbol: ZSCAN18
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Transfected 293T
  
  WB Suggested Anti-ZNF447 Antibody Titration: 1.0ug/ml
  ELISA Titer: 1:62500
  Positive Control: Transfected 293T