Product Number |
ARP33305_T100 |
Product Page |
www.avivasysbio.com/znf447-antibody-n-terminal-region-arp33305-t100.html |
Name |
ZNF447 Antibody - N-terminal region (ARP33305_T100) |
Protein Size (# AA) |
510 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
65982 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger and SCAN domain containing 18 |
Alias Symbols |
ZNF447 |
Peptide Sequence |
Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
SAFB2; LIG4; UBA52; APP; UBC; HOXD4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZSCAN18 (ARP33305_T100) antibody |
Blocking Peptide |
For anti-ZSCAN18 (ARP33305_T100) antibody is Catalog # AAP33305 (Previous Catalog # AAPP04347) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF447 |
Uniprot ID |
Q8TBC5 |
Protein Name |
Zinc finger and SCAN domain-containing protein 18 |
Protein Accession # |
NP_076415 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_023926 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZSCAN18 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF447 Antibody Titration: 1.0ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T |
|
|