Product Number |
ARP33286_P050 |
Product Page |
www.avivasysbio.com/shox2-antibody-middle-region-arp33286-p050.html |
Name |
SHOX2 Antibody - middle region (ARP33286_P050) |
Protein Size (# AA) |
331 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
6474 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Short stature homeobox 2 |
Alias Symbols |
OG12, SHOT, OG12X |
Peptide Sequence |
Synthetic peptide located within the following region: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Blaschke,R.J., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (5), 2406-2411 |
Description of Target |
SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified. |
Protein Interactions |
CDK4; ELAVL1; TRIM29; KDM5B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SHOX2 (ARP33286_P050) antibody |
Blocking Peptide |
For anti-SHOX2 (ARP33286_P050) antibody is Catalog # AAP33286 (Previous Catalog # AAPP04328) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SHOX2 |
Uniprot ID |
O60902 |
Protein Name |
Short stature homeobox protein 2 |
Protein Accession # |
NP_006875 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006884 |
Tested Species Reactivity |
Human |
Gene Symbol |
SHOX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|