| Product Number |
ARP33281_P050 |
| Product Page |
www.avivasysbio.com/znf336-antibody-n-terminal-region-arp33281-p050.html |
| Name |
ZNF336 Antibody - N-terminal region (ARP33281_P050) |
| Protein Size (# AA) |
711 amino acids |
| Molecular Weight |
80kDa |
| NCBI Gene Id |
64412 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
GDNF-inducible zinc finger protein 1 |
| Alias Symbols |
JLSM, ZBTB23, ZNF336 |
| Peptide Sequence |
Synthetic peptide located within the following region: LCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSVDGTRTNVYL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fukuda,N., et al., (2003) J. Biol. Chem. 278 (50), 50386-50392 |
| Description of Target |
ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. |
| Protein Interactions |
YBX1; NPM1; NFATC1; NCL; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GZF1 (ARP33281_P050) antibody |
| Blocking Peptide |
For anti-GZF1 (ARP33281_P050) antibody is Catalog # AAP33281 (Previous Catalog # AAPP04323) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF336 |
| Uniprot ID |
Q9H116 |
| Protein Name |
GDNF-inducible zinc finger protein 1 |
| Protein Accession # |
NP_071927 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022482 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GZF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human Heart
 | Human Heart |
| | Image 2 | Human HepG2
 | WB Suggested Anti-ZNF336 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
|
