ZNFN1A5 Antibody - N-terminal region (ARP33276_P050)

Data Sheet
 
Product Number ARP33276_P050
Product Page www.avivasysbio.com/znfn1a5-antibody-n-terminal-region-arp33276-p050.html
Name ZNFN1A5 Antibody - N-terminal region (ARP33276_P050)
Protein Size (# AA) 420 amino acids
Molecular Weight 47kDa
NCBI Gene Id 64376
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name IKAROS family zinc finger 5 (Pegasus)
Description
Alias Symbols THC7, PEGASUS, ZNFN1A5
Peptide Sequence Synthetic peptide located within the following region: MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Perdomo,J., et al., (2000) J. Biol. Chem. 275 (49), 38347-38354
Description of Target Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.
Protein Interactions IKZF5; CCDC85B; IKZF4; IKZF2; IKZF3; LDOC1; IKZF1; PUM2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IKZF5 (ARP33276_P050) antibody
Blocking Peptide For anti-IKZF5 (ARP33276_P050) antibody is Catalog # AAP33276 (Previous Catalog # AAPP04318)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNFN1A5
Uniprot ID Q8TBE5
Protein Accession # NP_071911
Purification Affinity Purified
Nucleotide Accession # NM_022466
Tested Species Reactivity Human
Gene Symbol IKZF5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Skin
Human Skin
Image 2
Human muscle
WB Suggested Anti-ZNFN1A5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com