ZNFN1A4 Antibody - N-terminal region (ARP33275_T100)

Data Sheet
 
Product Number ARP33275_T100
Product Page www.avivasysbio.com/znfn1a4-antibody-n-terminal-region-arp33275-t100.html
Name ZNFN1A4 Antibody - N-terminal region (ARP33275_T100)
Protein Size (# AA) 544 amino acids
Molecular Weight 60kDa
NCBI Gene Id 64375
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name IKAROS family zinc finger 4 (Eos)
Alias Symbols EOS, ZNFN1A4
Peptide Sequence Synthetic peptide located within the following region: NSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Perdomo,J., et al., (2002) Eur. J. Biochem. 269 (23), 5885-5892
Description of Target Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM].
Protein Interactions NFKBIA; FHL2; FOXP3; SIN3B; SIN3A; IKZF4; IKZF5; IKZF2; IKZF3; HDAC2; CHD4; IKZF1; NRG1; Ctbp1; HDAC7; HDAC5; HDAC4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IKZF4 (ARP33275_T100) antibody
Blocking Peptide For anti-IKZF4 (ARP33275_T100) antibody is Catalog # AAP33275 (Previous Catalog # AAPP04317)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNFN1A4
Uniprot ID Q96JP3
Protein Name Zinc finger protein Eos
Protein Accession # NP_071910
Purification Protein A purified
Nucleotide Accession # NM_022465
Tested Species Reactivity Human
Gene Symbol IKZF4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNFN1A4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human Lung
Rabbit Anti-IKZF4 Antibody
Catalog Number: ARP33275
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com