| Product Number |
ARP33271_P050 |
| Product Page |
www.avivasysbio.com/sox17-antibody-c-terminal-region-arp33271-p050.html |
| Name |
SOX17 Antibody - C-terminal region (ARP33271_P050) |
| Protein Size (# AA) |
414 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
64321 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 17 |
| Alias Symbols |
VUR3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Schepers,G.E., et al., (2002) Dev. Cell 3 (2), 167-170 |
| Description of Target |
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
| Protein Interactions |
CTNNB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX17 (ARP33271_P050) antibody |
| Blocking Peptide |
For anti-SOX17 (ARP33271_P050) antibody is Catalog # AAP33271 (Previous Catalog # AAPP04313) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX17 |
| Uniprot ID |
Q9H6I2 |
| Protein Name |
Transcription factor SOX-17 |
| Protein Accession # |
NP_071899 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022454 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SOX17 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Zebrafish: 92% |
| Image 1 | Human Lung
 | WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
| Image 2 | Mouse Testis, Rat Brain
 | Host: Rabbit
Target: SOX17
Positive control (+): Mouse Testis (M-TE)
Negative control (-): Rat Brain (R-BR)
Antibody concentration: 0.5ug/ml |
|
