| Product Number |
ARP33269_T100 |
| Product Page |
www.avivasysbio.com/sema4a-antibody-n-terminal-region-arp33269-t100.html |
| Name |
SEMA4A Antibody - N-terminal region (ARP33269_T100) |
| Protein Size (# AA) |
761 amino acids |
| Molecular Weight |
84kDa |
| NCBI Gene Id |
64218 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A |
| Alias Symbols |
RP35, SEMB, SEMAB, CORD10 |
| Peptide Sequence |
Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Puschel,A.W., et al., (1995) Neuron 14 (5), 941-948 |
| Description of Target |
SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses. |
| Protein Interactions |
DDX54; SEMA4A; HAVCR1; PLXND1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SEMA4A (ARP33269_T100) antibody |
| Blocking Peptide |
For anti-SEMA4A (ARP33269_T100) antibody is Catalog # AAP33269 (Previous Catalog # AAPP04311) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA4A |
| Uniprot ID |
Q5TCJ6 |
| Protein Name |
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (Semaphorin) 4A EMBL CAI15533.1 |
| Protein Accession # |
NP_071762 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_022367 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SEMA4A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SEMA4A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
