PRDM14 Antibody - middle region (ARP33262_T100)

• Product Number: ARP33262_T100
• Name: PRDM14 Antibody - middle region (ARP33262_T100)
• Protein Size (# AA): 571 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 63978
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: PR domain containing 14
• Alias Symbols: PFM11
• Peptide Sequence: Synthetic peptide located within the following region: GVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Xiao,B., et al., (2003) Curr Opin Struct Biol. 13(6), 699-705
• Description of Target: PRDM14 is part of a family of PR-domain genes that are involved in tumorigenesis.
• Protein Interactions: MIA3; TEKT4; TTC32; HEXIM2; ATPAF2; BEX2; RCOR3; GPATCH2L; CDCA7L; HSPB7; AKAP9; EIF4E2; CBFA2T2; RAD51D; PSMA1; RUNX1T1; DGCR6; PRKAB2; Dlg4; ID3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRDM14 (ARP33262_T100) antibody is Catalog # AAP33262 (Previous Catalog # AAPP04304)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM14
• Uniprot ID: Q9GZV8
• Protein Name: PR domain zinc finger protein 14
• Protein Accession #: NP_078780
• Purification: Protein A purified
• Nucleotide Accession #: NM_024504
• Tested Species Reactivity: Human
• Gene Symbol: PRDM14
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PRDM14 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate
• Image 2: Human Lung
  
  Human Lung