RORC Antibody - C-terminal region (ARP33244_P050)

• Product Number: ARP33244_P050
• Name: RORC Antibody - C-terminal region (ARP33244_P050)
• Protein Size (# AA): 518 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 6097
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: RAR-related orphan receptor C
• Alias Symbols: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
• Peptide Sequence: Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wang,H., et al., (2003) Mol. Genet. Metab. 79 (3), 176-182
• Description of Target: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: EVI2A; NCOA6; EIF3I; CHD4; EIF4EBP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RORC (ARP33244_P050) antibody is Catalog # AAP33244 (Previous Catalog # AAPS22101)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RORC
• Uniprot ID: P51449
• Protein Name: Nuclear receptor ROR-gamma
• Protein Accession #: NP_005051
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005060
• Tested Species Reactivity: Human
• Gene Symbol: RORC
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
• Image 1: Human kidney
  
  WB Suggested Anti-RORC Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human kidney
• Image 2: Human Fetal Heart
  
  Host: Rabbit
  Target Name: RORC
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml