ALX4 Antibody - N-terminal region (ARP33240_P050)

Data Sheet
 
Product Number ARP33240_P050
Product Page www.avivasysbio.com/alx4-antibody-n-terminal-region-arp33240-p050.html
Name ALX4 Antibody - N-terminal region (ARP33240_P050)
Protein Size (# AA) 411 amino acids
Molecular Weight 44kDa
NCBI Gene Id 60529
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ALX homeobox 4
Alias Symbols CRS5, FND2
Peptide Sequence Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wakui,K., et al., (2005) Eur. J. Hum. Genet. 13 (5), 528-540
Description of Target Alx4 is a member of the family of transcription factors that contain the paired-type homeodomain. In contrast to other types of homeodomains, the paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members. Alx4 is co-expressed with Cart1 at several sites during development, including the craniofacial mesenchyme, the mesenchymal derivatives of neural crest cells in the first branchial arch and the limb bud mesenchyme.
Protein Interactions ALX4; HOXB13; SOX2; HOXD3; HOXB6; HOXA3; FOXA3; GATA4; EMX1; CEBPE; SOX10; ALX1; LEF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ALX4 (ARP33240_P050) antibody
Blocking Peptide For anti-ALX4 (ARP33240_P050) antibody is Catalog # AAP33240 (Previous Catalog # AAPP04277)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ALX4
Uniprot ID Q9H161
Protein Name Homeobox protein aristaless-like 4
Protein Accession # NP_068745
Purification Affinity Purified
Nucleotide Accession # NM_021926
Tested Species Reactivity Human
Gene Symbol ALX4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com