Product Number |
ARP33240_P050 |
Product Page |
www.avivasysbio.com/alx4-antibody-n-terminal-region-arp33240-p050.html |
Name |
ALX4 Antibody - N-terminal region (ARP33240_P050) |
Protein Size (# AA) |
411 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
60529 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ALX homeobox 4 |
Alias Symbols |
CRS5, FND2 |
Peptide Sequence |
Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wakui,K., et al., (2005) Eur. J. Hum. Genet. 13 (5), 528-540 |
Description of Target |
Alx4 is a member of the family of transcription factors that contain the paired-type homeodomain. In contrast to other types of homeodomains, the paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members. Alx4 is co-expressed with Cart1 at several sites during development, including the craniofacial mesenchyme, the mesenchymal derivatives of neural crest cells in the first branchial arch and the limb bud mesenchyme. |
Protein Interactions |
ALX4; HOXB13; SOX2; HOXD3; HOXB6; HOXA3; FOXA3; GATA4; EMX1; CEBPE; SOX10; ALX1; LEF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ALX4 (ARP33240_P050) antibody |
Blocking Peptide |
For anti-ALX4 (ARP33240_P050) antibody is Catalog # AAP33240 (Previous Catalog # AAPP04277) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ALX4 |
Uniprot ID |
Q9H161 |
Protein Name |
Homeobox protein aristaless-like 4 |
Protein Accession # |
NP_068745 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_021926 |
Tested Species Reactivity |
Human |
Gene Symbol |
ALX4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
|