| Product Number |
ARP33193_P050 |
| Product Page |
www.avivasysbio.com/gatad1-antibody-c-terminal-region-arp33193-p050.html |
| Name |
GATAD1 Antibody - C-terminal region (ARP33193_P050) |
| Protein Size (# AA) |
269 amino acids |
| Molecular Weight |
29kDa |
| NCBI Gene Id |
57798 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
GATA zinc finger domain containing 1 |
| Alias Symbols |
ODAG, CMD2B, RG083M05.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tsuruga,T., et al., (2002) Gene 290 (1-2), 125-130 |
| Description of Target |
ODAG (Ocular development-associated gene), a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue. |
| Protein Interactions |
HECW2; HDAC1; ATXN1; EPHA2; SS18L1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GATAD1 (ARP33193_P050) antibody |
| Blocking Peptide |
For anti-GATAD1 (ARP33193_P050) antibody is Catalog # AAP33193 (Previous Catalog # AAPP04230) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GATAD1 |
| Uniprot ID |
Q8WUU5 |
| Protein Name |
GATA zinc finger domain-containing protein 1 |
| Sample Type Confirmation |
GATAD1 is strongly supported by BioGPS gene expression data to be expressed in K562 |
| Protein Accession # |
NP_066990 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021167 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GATAD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human K562
 | WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells |
|
