| Product Number |
ARP33168_P050 |
| Product Page |
www.avivasysbio.com/slc2a4rg-antibody-middle-region-arp33168-p050.html |
| Name |
SLC2A4RG Antibody - middle region (ARP33168_P050) |
| Protein Size (# AA) |
387 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
56731 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SLC2A4 regulator |
| Alias Symbols |
GEF, HDBP1, HDBP-1, Si-1-2, Si-1-2-19 |
| Peptide Sequence |
Synthetic peptide located within the following region: MQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tanaka,K., et al., (2004) J. Biol. Chem. 279 (8), 7275-7286 |
| Description of Target |
The protein encoded by SLC2A4RG is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. |
| Protein Interactions |
SLC2A4RG; HDAC5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC2A4RG (ARP33168_P050) antibody |
| Blocking Peptide |
For anti-SLC2A4RG (ARP33168_P050) antibody is Catalog # AAP33168 (Previous Catalog # AAPP04205) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A4RG |
| Uniprot ID |
Q9NR83 |
| Protein Name |
SLC2A4 regulator |
| Protein Accession # |
NP_064446 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020062 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC2A4RG |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Horse: 92%; Human: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC2A4RG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
